Cartilaginous fishes offer unique insights into the evolution of the nuclear receptor gene repertoire in gnathostomes E Fonseca, AM Machado, N Vilas-Arrondo, A Gomes-dos-Santos, ... General and Comparative Endocrinology 295, 113527, 2020 | 19 | 2020 |
Exploring deep-sea biodiversity in the Porcupine Bank (NE Atlantic) through fish integrative taxonomy R Bañón, A de Carlos, C Farias, N Vilas-Arrondo, F Baldó Journal of Marine Science and Engineering 9 (10), 1075, 2021 | 9 | 2021 |
Shedding light on the Chimaeridae taxonomy: the complete mitochondrial genome of the cartilaginous fish Hydrolagus mirabilis (Collett, 1904) (Holocephali … A Gomes-dos-Santos, N Vilas-Arrondo, AM Machado, A Veríssimo, ... Mitochondrial DNA Part B 6 (2), 420-422, 2021 | 7 | 2021 |
A mitochondrial genome assembly of the opal chimaera, Chimaera opalescens Luchetti, Iglésias et Sellos 2011, using PacBio HiFi long reads N Vilas-Arrondo, A Gomes-dos-Santos, M Pérez, F Baldó, A Veríssimo, ... Mitochondrial DNA Part B 7 (3), 434-437, 2022 | 5 | 2022 |
The complete mitochondrial genome of the deep-water cartilaginous fish Hydrolagus affinis (de Brito Capello, 1868) (Holocephali: Chimaeridae) A Gomes-dos-Santos, NV Arrondo, AM Machado, A Veríssimo, M Pérez, ... Mitochondrial DNA Part B 5 (2), 1810-1812, 2020 | 5 | 2020 |
A new gene order in the mitochondrial genome of the deep-sea diaphanous hatchet fish Sternoptyx diaphana Hermann, 1781 (Stomiiformes: Sternoptychidae) NV Arrondo, A Gomes-dos-Santos, E Roman Marcote, M Pérez, E Froufe, ... Mitochondrial DNA Part B 5 (3), 2850-2852, 2020 | 3 | 2020 |
First Confirmed Record of the Smalltooth Sand Tiger, Odontapis Ferox, in Galicia (NW Spain) G Mucientes, N Vilas-Arrondo, G Secci-Petretto, U Vázquez, X Pin, ... Thalassas: An International Journal of Marine Sciences 39 (1), 413-417, 2023 | 1 | 2023 |
Unusual Association of Skipjack Tunas Katsuwonus pelamis and a Longline Vessel G Mucientes, N Vilas-Arrondo Ocean Science Journal 56, 96-98, 2021 | 1 | 2021 |
Results for Greenland halibut, American plaice and Atlantic cod of the Spanish survey in NAFO Div. 3NO for the period 1997-2014 D González-Troncoso, E Román-Marcote, N Vilas-Arrondo, A Nogueira Centro Oceanográfico de Vigo, 2015 | 1 | 2015 |
Mitochondrial replication's role in vertebrate mtDNA strand asymmetry A Gomes-dos-Santos, N Vilas-Arrondo, AM Machado, E Román-Marcote, ... Open biology 13 (12), 230181, 2023 | | 2023 |
Workshop on Mitigation Measures to Reduce Bycatch of Short-Beaked Common Dolphins in the Bay of Biscay (WKEMBYC2) N Vilas Arrondo, M Authier, M Basterretxea, L Dubroca, A Henneveux, ... International Council for the Exploration of the Sea, 2023 | | 2023 |
Summary Report of the FLEMISH CAP International Survey COORDINATION MEETING (FCCM) 2023 A Pico-Calvo, JM Casas-Sánchez, MC González-Iglesias, ... | | 2023 |
Report of the ICES Working Group on Marine Mammal Ecology (WGMME) M Ahola, F Alves, M Authier, R Banga, S Brasseur, L Bundone, ... International Council for the Exploration of the Sea, 2023 | | 2023 |
Characterization of VMEs with DNA: mind the gap M Parrondo, N Vilas-Arrondo, D Casado, R Rodríguez-Mendoza, ... | | 2023 |
Genetics as a tool for sustainable fishing and protection of vulnerable marine ecosystems-VME N Vilas-Arrondo, M Parrondo, D Casado, R Rodríguez-Mendoza, ... | | 2023 |
Improving fisheries bycatch mitigation by technical measures in north Iberian waters J Valeiras, I Izquierdo, N Vilas-Arrondo, C Saavedra, P Gutiérrez, ... | | 2023 |
Effectiveness assessment of cetacean bycatch reduction strategies and fishing technical measures in Iberian waters and Bay of Biscay J Valeiras, A Marçalo, N Cozannet, JM Santos, N Vilas-Arrondo, ... | | 2023 |
ICES SCIENTIFIC REPORTS MEASURES TO REDUCE BYCATCH OF SHORT-BEAKED COMMON DOLPHINS IN THE BAY OF BISCAY (WKEMBYC2) NVAMAMBFBLDSFAHAKKMAMEMPGMPMSNCSPGPFPVRTRIFRGSQ Sourget ICES Scientific Reports. 5 (3), 96 pp, 2023 | | 2023 |
Cetacean excluder devices, a promising mitigation measure for dolphin's bycatch in pair trawl fisheries N Vilas-Arrondo, I Izquierdo, E Velasco, C Saavedra, P Gutiérrez, ... | | 2023 |
Rare but not absent: the Inverted Mitogenomes of Deep-Sea Hatchetfish A Gomes-dos-Santos, N Vilas-Arrondo, AM Machado, E Roman-Marcote, ... bioRxiv, 2023.06. 12.544378, 2023 | | 2023 |